| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003964 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0113966 | Gp0109827 | Ga0063593 |
| Sample Name | Enrichment cultures from Harmful Algal Blooms in Lake Erie, HABS-00-39864 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Michigan |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 45514801 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Brevundimonas | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Harmful Algal Blooms In Lake Erie |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Harmful Algal Blooms In Lake Erie |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | freshwater lake biome → glacial lake → microbial mat material |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Lake Fryxell, Antarctica | |||||||
| Coordinates | Lat. (o) | -77.611214 | Long. (o) | 163.119356 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F089831 | Metagenome | 108 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0063593_10008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Brevundimonas | 500060 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0063593_10008 | Ga0063593_10008280 | F089831 | MTLDPFARLLFLEAAKGLNRKASARFARRQAYLGRPVPRSSTDRRPDPGTLNDGDPEMG* |
| ⦗Top⦘ |