3300003964: Enrichment cultures from Harmful Algal Blooms in Lake Erie, HABS-00-39864

Overview

Basic Information

• IMG/M Taxon OID: 3300003964
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0113966 | Gp0109827 | Ga0063593
• Sample Name: Enrichment cultures from Harmful Algal Blooms in Lake Erie, HABS-00-39864
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Michigan
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 45514801
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Brevundimonas	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Harmful Algal Blooms In Lake Erie
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Harmful Algal Blooms In Lake Erie

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): freshwater lake biome → glacial lake → microbial mat material
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: Lake Fryxell, Antarctica
• Coordinates
  • Lat. (^o): -77.611214
  • Long. (^o): 163.119356
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089831	Metagenome	108	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0063593_10008	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Brevundimonas	500060

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0063593_10008	Ga0063593_10008280	F089831	MTLDPFARLLFLEAAKGLNRKASARFARRQAYLGRPVPRSSTDRRPDPGTLNDGDPEMG*