NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003953

3300003953: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS908_80_13INC



Overview

Basic Information
IMG/M Taxon OID3300003953 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0111355 | Gp0109932 | Ga0064035
Sample NameDiffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS908_80_13INC
Sequencing StatusPermanent Draft
Sequencing CenterMarine Biological Laboratory
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size1957109
Sequencing Scaffolds2
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pneumoniae1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDiffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine hydrothermal vent biomemarine hydrothermal venthydrothermal fluid
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationMarker 33 diffuse flow vent, Axial Seamount
CoordinatesLat. (o)45.9332Long. (o)-129.982268Alt. (m)N/ADepth (m)1516
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F054846Metagenome / Metatranscriptome139N
F074867Metagenome / Metatranscriptome119N
F078696Metagenome / Metatranscriptome116N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0064035_10694Not Available623Open in IMG/M
Ga0064035_11059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pneumoniae1057Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0064035_10694Ga0064035_106941F054846QGRESRKSLSEHDTERKPERVPMYAQRTMIDATLIPKGYHGHWVSNNPAGRIDMLLRAGYDFVTKDQNVYSSHVTENGVDSRVSKSGSDGVTLYLMIIPLELYEADQEAKAEKAKEQTATIFGKQRNDPDFFSRDENGRDTPASRGIGRVTTNDFVL*
Ga0064035_11059Ga0064035_110591F078696MKLWSSAVTYLNVQPSEAWNLTPFEFLALWDTHLEKMEISTGKAYTRPMTMDEFNELSDF
Ga0064035_11059Ga0064035_110592F074867MSNRGITDIMLNGEAFELHPTFSNLDKLETVLNKGAIGFLRQDLSSGAFKAGDVVSIIQVCAVPANGRKFPNWWNRDGVGEAVISAGLVGITTSVTHFLAKALTAGTETDIKTVGSESDEKK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.