3300003912: Compost microbial communities from Sao Paulo Zoo, Brazil - ZC4 m-RNA DAY 15

Overview

Basic Information

• IMG/M Taxon OID: 3300003912
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0047180 | Gp0107759 | Ga0063328
• Sample Name: Compost microbial communities from Sao Paulo Zoo, Brazil - ZC4 m-RNA DAY 15
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Sao Paulo, Virginia Bioinformatics Institute
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 40469612
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Compost Microbial Communities From Sao Paulo Zoo, Brazil
• Type: Engineered
• Taxonomy: Engineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost → Compost Microbial Communities From Sao Paulo Zoo, Brazil

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: Sao Paulo Zoo, Brazil
• Coordinates
  • Lat. (^o): -23.651072
  • Long. (^o): -46.620675
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059782	Metagenome	133	Y
F105419	Metagenome / Metatranscriptome	100	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0063328_1036525	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	576
Ga0063328_1049482	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	1105

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0063328_1036525	Ga0063328_10365252	F059782	MRVEFETARGRVVPGKGSQVAAFFVALEIESEQLTVPERGELLQRLTTRIIDAIAEEFGGEEIEVRRPRE*
Ga0063328_1049482	Ga0063328_10494822	F105419	VRKFIALSALLVAAAAANGCISTTMYGCEITETLAPGASEGEVIMKHGAPDNIVYLGTQYFNPQTGERGEVDKYLYEYRIGGGNTLLGQVFASDEFHNICYLIEGGRVMGGGYVGEGKGSIILGNDFGVLNTPLGSIDLRFGGFLHPKARAGYGGDGNPWGSADVPDNRN*