3300003897: Compost microbial communities from Sao Paulo Zoo, Brazil - ZC4 m-RNA DAY 03

Overview

Basic Information

• IMG/M Taxon OID: 3300003897
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0047180 | Gp0107757 | Ga0063326
• Sample Name: Compost microbial communities from Sao Paulo Zoo, Brazil - ZC4 m-RNA DAY 03
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Sao Paulo, Virginia Bioinformatics Institute
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 46628007
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales	1
All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Compost Microbial Communities From Sao Paulo Zoo, Brazil
• Type: Engineered
• Taxonomy: Engineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost → Compost Microbial Communities From Sao Paulo Zoo, Brazil

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: Sao Paulo Zoo, Brazil
• Coordinates
  • Lat. (^o): -23.651072
  • Long. (^o): -46.620675
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036417	Metagenome / Metatranscriptome	170	Y
F059782	Metagenome	133	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0063326_1061019	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales	625
Ga0063326_1061846	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	639

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0063326_1061019	Ga0063326_10610191	F059782	VRVEFETARGRVVPGKGSQVAAFFVSLEVHSEQLSVPERAELTQRLTTRIAEVIAEEFGGEEIEVRRSRE*
Ga0063326_1061846	Ga0063326_10618461	F036417	VLVRLATDDGEVVFRARWTRSPLELQRNILFRMRRGSLLWFQDEWGHDLCFRPECVYAAMVDGR*