3300003875: Plastic marine debris microbial communities from the Atlantic Ocean - SEA_0063_20120523_metagen

Overview

Basic Information

• IMG/M Taxon OID: 3300003875
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0113941 | Gp0109642 | Ga0063277
• Sample Name: Plastic marine debris microbial communities from the Atlantic Ocean - SEA_0063_20120523_metagen
• Sequencing Status: Permanent Draft
• Sequencing Center: Marine Biological Laboratory
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 58861724
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia	1
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Plastic Marine Debris Microbial Communities From The Atlantic Ocean
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Plastic Marine Debris Microbial Communities From The Atlantic Ocean

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → manufactured plastic
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Surface (saline)

Location Information

• Location: Atlantic Ocean
• Coordinates
  • Lat. (^o): 27.32333
  • Long. (^o): -63.565
  • Alt. (m): N/A
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007917	Metagenome / Metatranscriptome	342	Y
F021307	Metagenome / Metatranscriptome	219	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0063277_1075272	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia	1028
Ga0063277_1142874	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	504

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0063277_1075272	Ga0063277_10752721	F007917	MSKDDIVCLLMILNVNRYANVILERSLRANEGHIGVNESIMTVMKQIWTQMNVYFA*
Ga0063277_1142874	Ga0063277_11428742	F021307	MNRILYDNRCRCNEEFSPIKKRQSIGKSEGKSLQYPKSTEVTSKIFQFKYEYNLSSTAKFILNSFQNKYLYYAIDDILYGLKTNLNERDNLLEIL