3300003868: Alpena Fountain idba assembled

Overview

Basic Information

• IMG/M Taxon OID: 3300003868
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0085322 | Gp0089178 | Ga0062456
• Sample Name: Alpena Fountain idba assembled
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Michigan
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 45207620
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Fountain Water Microbial Communities From Alpena County Library, Michigan, Usa
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Fountain Water → Fountain Water Microbial Communities From Alpena County Library, Michigan, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): freshwater biome → fountain → fresh water
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: Alpena Town, Michigan
• Coordinates
  • Lat. (^o): 45.062461
  • Long. (^o): -83.431242
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050966	Metagenome / Metatranscriptome	144	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0062456_1008362	Not Available	964

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0062456_1008362	Ga0062456_10083622	F050966	MRENLMSGSRWQGMKTRHGDGTEALSQEMESNGSATPKSRRHPLTLPADVWDSARFTSIF