3300003838: Agave microbial communities from Guanajuato, Mexico - At.P.rz

Overview

Basic Information

• IMG/M Taxon OID: 3300003838
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053055 | Gp0104143 | Ga0058691
• Sample Name: Agave microbial communities from Guanajuato, Mexico - At.P.rz
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 253365543
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Beephvirinae	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Agave Microbial Communities From California, Usa, And Mexico
• Type: Host-Associated
• Taxonomy: Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave → Agave Microbial Communities From California, Usa, And Mexico

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface

Location Information

• Location: Guanajuato, Mexico
• Coordinates
  • Lat. (^o): 20.6863
  • Long. (^o): -101.8747
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077883	Metagenome	117	Y
F097652	Metagenome / Metatranscriptome	104	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0058691_1000369	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Beephvirinae	33277
Ga0058691_1093834	Not Available	549

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0058691_1000369	Ga0058691_100036925	F097652	MANWVFITPTVDEAPFAWSPLMERFRLTRGVSVVEVSPGQYETTRYDAYTNELGAENLPQNPNQDTEFWPAERAGLHYFRGGYEWIVDDQIRSDIIASGAATAANFTPV*
Ga0058691_1093834	Ga0058691_10938341	F077883	LKLYFNPCIYNSMSFVIIKKGEIVGPKALHPSFDDDQLM*