3300003811: Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA4M

Overview

Basic Information

• IMG/M Taxon OID: 3300003811
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0110170 | Gp0088264 | Ga0007802
• Sample Name: Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA4M
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 18489198
• Sequencing Scaffolds: 1
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): freshwater lake biome → freshwater lake → lake water
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: Crystal Bog, Wisconsin, USA
• Coordinates
  • Lat. (^o): 46.0072
  • Long. (^o): -89.6063
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024742	Metagenome / Metatranscriptome	204	Y
F088507	Metagenome / Metatranscriptome	109	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0007802_103282	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	634

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0007802_103282	Ga0007802_1032822	F088507	MTNCCNANGECTQGRDCPIRKQRAQEANDAFMNRNNGLEPDLIDDLAASVKGLIALVCVATGVAMIAFAFWGK*
Ga0007802_103282	Ga0007802_1032823	F024742	MNNETQRIMEALMLIYGSDLQAATITVLLKDGDTAVRYLSSTFPQKEKQDDTN*