3300003794: Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2

Overview

Basic Information

• IMG/M Taxon OID: 3300003794
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053073 | Gp0101304 | Ga0055531
• Sample Name: Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 333072778
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations
• Type: Host-Associated
• Taxonomy: Host-Associated → Plants → Roots → Endophytes → Unclassified → Arabidopsis Root → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere

Location Information

• Location: USA: North Carolina
• Coordinates
  • Lat. (^o): 35.6667
  • Long. (^o): -78.5097
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F044595	Metagenome	154	Y
F105520	Metagenome / Metatranscriptome	100	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0055531_10001358	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	18196
Ga0055531_10045510	Not Available	1217

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0055531_10001358	Ga0055531_1000135814	F105520	MDALSRTELDFLHRLLLDLQRESEDHGDAAGVAALELALAILRWDGETPPALDAQVGLGAAIQSRLGLDALCAWQQWRTERRRRPALTP*
Ga0055531_10045510	Ga0055531_100455107	F044595	LIERHFLESVIVKSAYVVTANRPMNGLVAFVRAAAMKSIGGCASALHPSLPTSYQRLDRNEDQVHPGEGSA*