3300003729: Soil microbial communities from Colorado Plateau, Utah, USA - Soil Crust after wet up 3C (Custom Analysis)

Overview

Basic Information

• IMG/M Taxon OID: 3300003729
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0063445 | Gp0056835 | Ga0006123
• Sample Name: Soil microbial communities from Colorado Plateau, Utah, USA - Soil Crust after wet up 3C (Custom Analysis)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 12179898
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter xylanophilus	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Soil Microbial Communities From Four Geographically Distinct Crusts In The Colorado Plateau And Sonoran Desert
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Four Geographically Distinct Crusts In The Colorado Plateau And Sonoran Desert

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): desert biome → desert → soil biocrust
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: Colorado Plateau and Sonoran desert
• Coordinates
  • Lat. (^o): 38.42
  • Long. (^o): -109.4099
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041063	Metagenome / Metatranscriptome	160	Y
F059546	Metagenome / Metatranscriptome	133	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0006123_100556	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter xylanophilus	521
Ga0006123_102800	Not Available	506

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0006123_100556	Ga0006123_1005561	F059546	LKKMMMLAALLAMLVVAAIPAIAQVEQGFEQETDSGEVEQSFEISGSGDNGNQCANVNGTTNTGNLQNQSGSIQYASDIEEFEQEEIGSDLSVTGTGSVTCEQQVNQAAAAG*
Ga0006123_102800	Ga0006123_1028001	F041063	ERLASSGRGAACLVDLGLGVRVAEGKVTMSRISYKRLGAALISLSVPFMMAGPVAAQPEAAEVASVELACLALGFDVNTCTFAVREGVYDVVEDVVNADLGDQGLAYVVDVGEEVGEEPGEFGADINEIAINPLPPVAATGEVLLPPSAVLE*