3300003656: Sal2totalprecorrection

Overview

Basic Information

• IMG/M Taxon OID: 3300003656
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0069917 | Gp0108330 | Ga0062185
• Sample Name: Sal2totalprecorrection
• Sequencing Status: Permanent Draft
• Sequencing Center: Lifesequencing S.L.
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 1948509
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → environmental samples → uncultured virus	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Hypersaline Viral And Bacterial Communities From Bras Del Port, Santa Pola, Spain
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hypersaline Samples → Hypersaline Viral And Bacterial Communities From Bras Del Port, Santa Pola, Spain

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): aquatic biome → saline evaporation pond → hypersaline water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Hypersaline (saline)

Location Information

• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072017	Metagenome	121	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Sal2_10108	All Organisms → Viruses → environmental samples → uncultured virus	923

Sequences

Scaffold ID	Protein ID	Family	Sequence
Sal2_10108	Sal2_101083	F072017	KRGSKQMSKSTTSSLESQSDTNLKSTVHKHDAIHAVTQEHIDVFDEDDRLLDFYEWQQIIRSSETTVRRLAYSEIEEGVDQ*