| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003642 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0047180 | Gp0107757 | Ga0061058 |
| Sample Name | Compost microbial communities from Sao Paulo Zoo, Brazil - ZC4 m-RNA DAY 03 (ZC4-mRNA-DAY-03) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Sao Paulo, Virginia Bioinformatics Institute |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 23922628 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Compost Microbial Communities From Sao Paulo Zoo, Brazil |
| Type | Engineered |
| Taxonomy | Engineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost → Compost Microbial Communities From Sao Paulo Zoo, Brazil |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Sao Paulo Zoo, Brazil | |||||||
| Coordinates | Lat. (o) | -23.651072 | Long. (o) | -46.620675 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F105419 | Metagenome / Metatranscriptome | 100 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| ZC4mRNADay03_133204 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 520 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| ZC4mRNADay03_133204 | ZC4mRNADay03_1332041 | F105419 | VRKFIALSALLVAAAAANGCISTTMYGCEITETLAPGASEGEVIMKHGAPDNIVYLGTQYFNPQTGERGEVDKYLYEYRIGGGNTLLGQVFASDEFHNICYLIEGGRVMGGGYVGEGKGSIILGNDFGVLNTPLGSIDLRFGGFLHPKARAGYGGDG |
| ⦗Top⦘ |