3300003536: Petroleum reservoir microbial communities from Reconcavo Basin, Brazil, analyzing oil degradation - Bahia-well BA-2 Water

Overview

Basic Information

• IMG/M Taxon OID: 3300003536
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0112330 | Gp0107645 | Ga0060331
• Sample Name: Petroleum reservoir microbial communities from Reconcavo Basin, Brazil, analyzing oil degradation - Bahia-well BA-2 Water
• Sequencing Status: Permanent Draft
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 106668796
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Kosmotogales → Kosmotogaceae → Mesotoga	1
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Petroleum Reservoir Microbial Communities From Reconcavo Basin, Brazil, Analyzing Oil Degradation
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Unclassified → Unclassified → Unclassified → Petroleum Reservoir → Petroleum Reservoir Microbial Communities From Reconcavo Basin, Brazil, Analyzing Oil Degradation

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): terrestrial biome → oil reservoir → oil field production water
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: Brazil: State of Brazil
• Coordinates
  • Lat. (^o): -12.2
  • Long. (^o): -38.11
  • Alt. (m): N/A
  • Depth (m): 500 to 1000

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022008	Metagenome / Metatranscriptome	216	Y
F070092	Metagenome	123	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ba2Water_1004441	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Kosmotogales → Kosmotogaceae → Mesotoga	6109
Ba2Water_1008399	All Organisms → cellular organisms → Bacteria	18115

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ba2Water_1004441	Ba2Water_10044415	F070092	MAINDRLKPVMELLETNRQKIGLMISHGMASDLAIERRKKELYDEVMTAKENAFKEELADLEGEIKKIEYSYHEPKKDPTTKLLEFEQIKAKIRSTPSKELKELTHTFQNTGTIPGIPWERPDHVDVLVAELRNRGLDEEADLTWDYAYNKLKVDRPWENNPLYKQLKSQQNKVSVLAGFKDMLKYLDGTNNAVYISEILKYKG*
Ba2Water_1008399	Ba2Water_100839911	F022008	MTVSEIEMLREALADLSKQVQALSEDNRTSFGRIYDRLTKIETQMSERECQFRKFEKALDNHETRIRSVEGELGTLRDVPERLWRVSMSNSKLTGMVMAAGGMGGLVATLIVRILGE*