3300003449: Marine sediment microbial communities from Douglas Channel, Canada, that are oil-degrading - Sample S9-DC07C

Overview

Basic Information

• IMG/M Taxon OID: 3300003449
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0111425 | Gp0104222 | Ga0059324
• Sample Name: Marine sediment microbial communities from Douglas Channel, Canada, that are oil-degrading - Sample S9-DC07C
• Sequencing Status: Permanent Draft
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 29027271
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Marine Sediment Microbial Communities From Douglas Channel, Canada, That Are Oil-Degrading
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From Douglas Channel, Canada, That Are Oil-Degrading

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine neritic zone → marine sediment
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Sediment (saline)

Location Information

• Location: Douglas Channel, British Columbia, Canada
• Coordinates
  • Lat. (^o): 53.6667
  • Long. (^o): -129.1333
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047369	Metagenome	150	N
F103272	Metagenome	101	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
DC07C_1069776	Not Available	532
DC07C_1224287	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	589

Sequences

Scaffold ID	Protein ID	Family	Sequence
DC07C_1069776	DC07C_10697762	F103272	MNYLTDREKDLIKYKKQYLELVYKITRLQLSGEDPPGKLLKQMQEIGRAAEIPETFLRSI
DC07C_1224287	DC07C_12242871	F047369	AIKSRGTNPMFVYTYGGKPLYDKPNPRFNPGVPEGAPWGEVLIGKLKPNSKGDCSDAYGIDHSDTASGWVPLLYDLAMDWASQNGGDLTSDRGSVSRDAFRVWEYYLEKRPDVESIPLDIRNRGYGKITPDDESDDCEQAISVKYARDTNSDPKWGWSAQPTAYLYRVSGTPTTDALEASGQFLDQMEE*