Basic Information | |
---|---|
IMG/M Taxon OID | 3300003426 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118793 | Gp0095086 | Ga0041907 |
Sample Name | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_750_plan |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 231002086 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium | 1 |
Not Available | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Wastewater Bioreactor Microbial Communities From Cape Town, South Africa |
Type | Engineered |
Taxonomy | Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | South Africa: Cape Town | |||||||
Coordinates | Lat. (o) | -33.927 | Long. (o) | 18.452665 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001866 | Metagenome | 624 | Y |
F017253 | Metagenome | 242 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
JGI26534J51046_1044392 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium | 819 | Open in IMG/M |
JGI26534J51046_1075036 | Not Available | 545 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
JGI26534J51046_1044392 | JGI26534J51046_10443921 | F017253 | FSLCRFSLTANVGSYTQGRIAGDFLSSRKAARAERCPRKTTAAALAG* |
JGI26534J51046_1075036 | JGI26534J51046_10750361 | F001866 | MAIVSECLQPIVVGVGDDDTALVGDTYSLWVVELAWLIALRAEHEQERAIDQRQYLHSAVAAVRDDDSMSIMIDRNALREAELSRLRSFLTTDLEQEREIDRRQEHQSMALGIDDDACRSQCLEAR* |
⦗Top⦘ |