NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003426

3300003426: Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_750_plan



Overview

Basic Information
IMG/M Taxon OID3300003426 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0118793 | Gp0095086 | Ga0041907
Sample NameWastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_750_plan
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size231002086
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameWastewater Bioreactor Microbial Communities From Cape Town, South Africa
TypeEngineered
TaxonomyEngineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationSouth Africa: Cape Town
CoordinatesLat. (o)-33.927Long. (o)18.452665Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001866Metagenome624Y
F017253Metagenome242Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI26534J51046_1044392All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium819Open in IMG/M
JGI26534J51046_1075036Not Available545Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI26534J51046_1044392JGI26534J51046_10443921F017253FSLCRFSLTANVGSYTQGRIAGDFLSSRKAARAERCPRKTTAAALAG*
JGI26534J51046_1075036JGI26534J51046_10750361F001866MAIVSECLQPIVVGVGDDDTALVGDTYSLWVVELAWLIALRAEHEQERAIDQRQYLHSAVAAVRDDDSMSIMIDRNALREAELSRLRSFLTTDLEQEREIDRRQEHQSMALGIDDDACRSQCLEAR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.