3300003167: Upper troposphere microbial communities from Maryland, USA - DAQMD-021

Overview

Basic Information

• IMG/M Taxon OID: 3300003167
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0110167 | Gp0085191 | Ga0007637
• Sample Name: Upper troposphere microbial communities from Maryland, USA - DAQMD-021
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 19166657
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Hypericibacter → Hypericibacter terrae	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei
• Type: Environmental
• Taxonomy: Environmental → Air → Outdoor Air → Unclassified → Unclassified → Upper Troposphere → Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Aerosol (non-saline)

Location Information

• Location: USA: Maryland, Virginia
• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024268	Metagenome / Metatranscriptome	206	Y
F091607	Metagenome / Metatranscriptome	107	N

Associated Scaffolds

Scaffold	Taxonomy	Length
JGI25826J46367_105628	Not Available	677
JGI25826J46367_106480	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Hypericibacter → Hypericibacter terrae	601

Sequences

Scaffold ID	Protein ID	Family	Sequence
JGI25826J46367_105628	JGI25826J46367_1056282	F091607	MSLETQISELNATIKTLNENILLLLGSKEQHSKVECSPVEPANLGQTEQQTFLPEVAKSDEYTREQLQSLCLEATKRNAAXRDIXXAIMLSNFEARKTGDLADNQINLCY
JGI25826J46367_106480	JGI25826J46367_1064801	F024268	MITEFFANSEAVGSTEWSLTTDTAGPDVEVTKGCFQIFLDISDMIAGDELEIKIYEKVQSSDTQRVIYQSNLIGPQSPAVWVSPSLILLNGWDVTLKTIAGGTITVSWSIRKAG*