3300003092: Hot spring microbial communities from Five Geothermal Springs in Yellowstone National Park, USA - Joseph's Coat Hot Spring-Scorodite Spring

Overview

Basic Information

• IMG/M Taxon OID: 3300003092
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0061992 | Gp0051686 | Ga0051078
• Sample Name: Hot spring microbial communities from Five Geothermal Springs in Yellowstone National Park, USA - Joseph's Coat Hot Spring-Scorodite Spring
• Sequencing Status: Permanent Draft
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 3876971
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Caldivirga → unclassified Caldivirga → Caldivirga sp. MU80	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Hot Spring Microbial Communities From Five Geothermal Springs In Yellowstone National Park, Usa
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Five Geothermal Springs In Yellowstone National Park, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): aquatic biome → hot spring → spring water
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: Joseph's Coat Hot Spring and Scorodite Spring, Yellowstone National Park, USA
• Coordinates
  • Lat. (^o): 44.969421
  • Long. (^o): -110.690383
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105516	Metagenome	100	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0051078_101069	All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Caldivirga → unclassified Caldivirga → Caldivirga sp. MU80	1226

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0051078_101069	Ga0051078_1010693	F105516	MPRAIVRVLALGRVSLNLKTFRVTASERLSVDSDGTVNCLGGDCSANGTFITLETEHPNPRELYDALKKVRVLELEVEIHGLPNWLLSRLEFLVGKPTSDKVRYTWHKMPSFGELALVLNDLNLNA*