3300002927: Delisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - 2012_LB_H21

Overview

Basic Information

• IMG/M Taxon OID: 3300002927
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0103015 | Gp0097844 | Ga0052912
• Sample Name: Delisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - 2012_LB_H21
• Sequencing Status: Permanent Draft
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 1008368351
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Delisea Pulchra Microbial Communities From Sydney, Australia, Affected By Bleaching Disease
• Type: Host-Associated
• Taxonomy: Host-Associated → Algae → Red Algae → Unclassified → Unclassified → Delisea Pulchra → Delisea Pulchra Microbial Communities From Sydney, Australia, Affected By Bleaching Disease

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Surface (saline)

Location Information

• Location: Long Bay, Sydney Australia
• Coordinates
  • Lat. (^o): -33.57
  • Long. (^o): 150.15
  • Alt. (m): N/A
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056191	Metagenome / Metatranscriptome	138	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
LBH21_10016480	All Organisms → cellular organisms → Eukaryota	1894

Sequences

Scaffold ID	Protein ID	Family	Sequence
LBH21_10016480	LBH21_100164802	F056191	LTLNNLYDVARVRHVLTAEMSETLLSWGSMHASVKLEGIDGRAPQERVEHVA*