| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300002812 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0095510 | Gp0072104 | Ga0007229 |
| Sample Name | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A5-12 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 1534833 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 2 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts) |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts) |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → agricultural field → agricultural soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Wisconsin, United States | |||||||
| Coordinates | Lat. (o) | 43.3 | Long. (o) | -89.38 | Alt. (m) | N/A | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F054151 | Metagenome / Metatranscriptome | 140 | N |
| F080568 | Metagenome / Metatranscriptome | 115 | Y |
| F098176 | Metagenome | 104 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| JGI25488J38603_10005 | Not Available | 1557 | Open in IMG/M |
| JGI25488J38603_10016 | Not Available | 1069 | Open in IMG/M |
| JGI25488J38603_10087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 605 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| JGI25488J38603_10005 | JGI25488J38603_100051 | F098176 | LVASYRNTSETLVPRGRKRNRMYLGLLRADLLENDGTIIAGDATAVRSAMNELNTALEGITDADPIFAPQGLAIVSPTAGECYEVNEVGCGEAVDTHRSRRQKEPENMIWQAAS* |
| JGI25488J38603_10016 | JGI25488J38603_100161 | F080568 | MAATPSIKITKQFTYRGVTKQFSNRYHFNGGTPADNAHWTTLADAIVTAEKVCYSSVVTIVKATGYAAGSEVPVFTKTYSTVGTSVWTGGTQTPGDCAAVVRYATAVRTAKNHPIYLFNYYHGAYNAAGAPDTLIAAQSGQLQAYANTWIGAGFSDGTTSYNRAGPNGATATGALVEPLISHRDLPR* |
| JGI25488J38603_10087 | JGI25488J38603_100871 | F054151 | LADHFRALAEGLSLRAVSERAPAQRAELQRLAECYAELAKQQSPADHFARGVGPR* |
| ⦗Top⦘ |