3300002727: Soil microbial communities from Rifle, Colorado - Rifle Oxygen_injection B1

Overview

Basic Information

• IMG/M Taxon OID: 3300002727
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053054 | Gp0056924 | Ga0005062
• Sample Name: Soil microbial communities from Rifle, Colorado - Rifle Oxygen_injection B1
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 105275472
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Predicted Viral	1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella → Prevotella buccae	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Soil Microbial Communities From Rifle, Colorado, Usa
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Loam → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): terrestrial biome → land → soil
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: Rifle, Colorado, United States
• Coordinates
  • Lat. (^o): 39.534762
  • Long. (^o): -107.782602
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016087	Metagenome / Metatranscriptome	250	Y
F079636	Metagenome	115	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
C687J39217_1001934	All Organisms → Viruses → Predicted Viral	3725
C687J39217_1036312	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella → Prevotella buccae	597

Sequences

Scaffold ID	Protein ID	Family	Sequence
C687J39217_1001934	C687J39217_10019343	F016087	METFWKILNKLMDYLGTLAVALLFAMLAFSVGYHVGFSSGLDTKVTWVGEKYTMKVTGKAAKR*
C687J39217_1036312	C687J39217_10363121	F079636	GMYNINGNASSFGKFIADGSEAYNSYTIENPNLVNADGTINTLGETQVLGFDLTTNDSLVMPIRKEFEAHDDPTLLRKQKQGFFGWADLGFACLDSRMLGMGIIDRSL*