3300002695: Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Biofilm from sections of failed pipe of Encana Pipeline

Overview

Basic Information

• IMG/M Taxon OID: 3300002695
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0047444 | Gp0091716 | Ga0024847
• Sample Name: Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Biofilm from sections of failed pipe of Encana Pipeline
• Sequencing Status: Permanent Draft
• Sequencing Center: McGill University
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 18136085
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Hydrocarbon Resource Environments Microbial Communities From Canada And Usa
• Type: Engineered
• Taxonomy: Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: Fort McMurray, Alberta, Canda
• Coordinates
  • Lat. (^o): 55.07
  • Long. (^o): -110.53
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079376	Metagenome / Metatranscriptome	116	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
draft_107556	All Organisms → cellular organisms → Bacteria	937

Sequences

Scaffold ID	Protein ID	Family	Sequence
draft_107556	draft_1075562	F079376	PCVSFGVSRVCRTTEKGERQMRHRESDSLVVPVKAGNAAGGKEATHGSVV*