3300002642: Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI074_135m_B (Metagenome Metatranscriptome)

Overview

Basic Information

• IMG/M Taxon OID: 3300002642
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0046785 | Gp0055388 | Ga0005258
• Sample Name: Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI074_135m_B (Metagenome Metatranscriptome)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 1064993
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → coastal inlet → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: British Columbia, Canada
• Coordinates
  • Lat. (^o): 48.7299
  • Long. (^o): -123.5699
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090440	Metagenome / Metatranscriptome	108	N
F098669	Metagenome / Metatranscriptome	103	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0005258J37292_10035	Not Available	500
Ga0005258J37292_10223	Not Available	543

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0005258J37292_10035	Ga0005258J37292_100351	F098669	METATRGRKQKWRLKEAEGLGRKWRIEETERRELHESDQGLDPGHGLNPGRKVRRIDQAMEGSPEIVPAKIRK
Ga0005258J37292_10223	Ga0005258J37292_102231	F090440	GNEISGLKLATDLRLKRVYHCRITDVGEDDDLRIIIRKSIGG*