| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300002590 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0111355 | Gp0093355 | Ga0041812 |
| Sample Name | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS903_30_12H |
| Sequencing Status | Permanent Draft |
| Sequencing Center | |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 1547689 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine hydrothermal vent biome → marine hydrothermal vent → hydrothermal fluid |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Marker 113, Axial Seamount | |||||||
| Coordinates | Lat. (o) | 45.922741 | Long. (o) | -129.988104 | Alt. (m) | N/A | Depth (m) | 1522 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F019998 | Metagenome / Metatranscriptome | 226 | N |
| F042865 | Metagenome / Metatranscriptome | 157 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| FS9033012H_10308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 701 | Open in IMG/M |
| FS9033012H_10844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus | 510 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| FS9033012H_10308 | FS9033012H_103081 | F042865 | MSLRVPDYETFLAADDFNKRIWWQFMQSVVNDLPLNGNVAPENTIRANKSCLYVESTGGTAVLWFN |
| FS9033012H_10844 | FS9033012H_108441 | F019998 | MWYKVNTVVGQVVNLYEVGTTTAASLDYAASVDAIVVGFTTLVWQPLRIIEARRKDLSSDIEVPLMIVGKFDYERIPNKAMTSIPLWLYAQTKIAETQVFVWPPTAYANWAIGYSFERRYQDVDSGINSMDFPPEAYESLRYGLAARLGDEFPIDPQRQAMLEQKAAGY |
| ⦗Top⦘ |