| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300002405 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0060821 | Gp0055165 | Ga0005524 |
| Sample Name | Earthworm egg capsule microbial community from the University of Washington, USA - E. fetida Yelm |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 327507020 |
| Sequencing Scaffolds | 12 |
| Novel Protein Genes | 12 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 10 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 1 |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Earthworm Egg Capsule Microbial Community From The University Of Washington, Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Annelida → Reproductive System → Egg Capsule → Unclassified → Earthworm Egg Capsule → Earthworm Egg Capsule Microbial Community From The University Of Washington, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal corpus |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | University of Washington, USA | |||||||
| Coordinates | Lat. (o) | 47.0 | Long. (o) | -122.0 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F033330 | Metagenome | 177 | Y |
| F077889 | Metagenome | 117 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| G312J29652_10003559 | Not Available | 3136 | Open in IMG/M |
| G312J29652_10022306 | Not Available | 869 | Open in IMG/M |
| G312J29652_10024641 | Not Available | 832 | Open in IMG/M |
| G312J29652_10027652 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA | 793 | Open in IMG/M |
| G312J29652_10034443 | Not Available | 728 | Open in IMG/M |
| G312J29652_10058643 | Not Available | 608 | Open in IMG/M |
| G312J29652_10068792 | Not Available | 577 | Open in IMG/M |
| G312J29652_10069116 | Not Available | 576 | Open in IMG/M |
| G312J29652_10072713 | Not Available | 567 | Open in IMG/M |
| G312J29652_10074221 | Not Available | 563 | Open in IMG/M |
| G312J29652_10084854 | Not Available | 540 | Open in IMG/M |
| G312J29652_10104405 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus | 506 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| G312J29652_10003559 | G312J29652_100035591 | F077889 | FKXXYFFMSNSVNFYEFIGFITFNIEVHELVYENSFLVDRILVSNVLRATVRRH* |
| G312J29652_10022306 | G312J29652_100223063 | F077889 | MSNSVNFYELIGFITFNIEVHELVYVYSVLVDRILVSNATVCRH* |
| G312J29652_10024641 | G312J29652_100246412 | F077889 | MSNSVNFYEFIGFITFNIEVHELVHVYSFLVDRILVSNVQRATARRH* |
| G312J29652_10027652 | G312J29652_100276522 | F077889 | MSNSVNFYEFIGFITFNIEVHELVYVYSFLVDRILVSNVPRATVGRH* |
| G312J29652_10034443 | G312J29652_100344431 | F077889 | MSNSVNFYELTGFITFNIEVHELVYEYSVLVDRILVSNVPRATVCRH* |
| G312J29652_10058643 | G312J29652_100586433 | F077889 | MSNSVNLYEFIGFITFNIEVHELVDVYSFLVDCILVSNVPRATVHRH* |
| G312J29652_10068792 | G312J29652_100687921 | F077889 | EFIGFITFNIEVHELVYMYSFLVDRILLSNVPRATVRRH* |
| G312J29652_10069116 | G312J29652_100691162 | F077889 | MSNSVNFYEFILFITFNIEVHELVYVYRFLVDRILVSNVRRATVRRL* |
| G312J29652_10072713 | G312J29652_100727131 | F077889 | MSDSVNFYEFIGFITFNIEVHELVYVYSFLVDRILVSNVPRATVHRH* |
| G312J29652_10074221 | G312J29652_100742211 | F077889 | MSNSVNFFEFIGFITFNVEVHELVYVCSFLVYRILVSNVPRATVRRHXNLKT* |
| G312J29652_10084854 | G312J29652_100848541 | F077889 | VSNSVNFDEFIGFITFNIEVHELVTCSFLVDRILVSNVPHATVLRQLDIKT* |
| G312J29652_10104405 | G312J29652_101044051 | F033330 | MVSVCVSSLGRTSNYFVELGIKINGQYYRDVLLMEDRLPEIL* |
| ⦗Top⦘ |