3300002193: Compost microbial communities from Sao Paulo Zoo, Brazil - ZC3b day 30

Overview

Basic Information

• IMG/M Taxon OID: 3300002193
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0047180 | Gp0072814 | Ga0022221
• Sample Name: Compost microbial communities from Sao Paulo Zoo, Brazil - ZC3b day 30
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Sao Paulo, Virginia Bioinformatics Institute
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 75159997
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Compost Microbial Communities From Sao Paulo Zoo, Brazil
• Type: Engineered
• Taxonomy: Engineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost → Compost Microbial Communities From Sao Paulo Zoo, Brazil

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: Sao Paulo Zoo, Brazil
• Coordinates
  • Lat. (^o): -23.651072
  • Long. (^o): -46.620675
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099151	Metagenome / Metatranscriptome	103	N

Associated Scaffolds

Scaffold	Taxonomy	Length
metazooDRAFT_1161919	Not Available	686

Sequences

Scaffold ID	Protein ID	Family	Sequence
metazooDRAFT_1161919	metazooDRAFT_11619192	F099151	MIMKFREETYKENGRIIKKYFIDDKEVTQDVFFKLTDELYENAKFIQDEHPDEICNCDDCQYLSDLIREIKIASDSEALDILKNKIDFRVQEAYIQGQHVLANELGNSLLKHAVKLEDELENLYENSSSHEYNEDS*