3300002096: Groundwater microbial communities from Rifle, Colorado - Rifle Oxygen_injection B2

Overview

Basic Information

• IMG/M Taxon OID: 3300002096
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053054 | Gp0056925 | Ga0005063
• Sample Name: Groundwater microbial communities from Rifle, Colorado - Rifle Oxygen_injection B2
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 121439435
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Soil Microbial Communities From Rifle, Colorado, Usa
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Soil Microbial Communities From Rifle, Colorado, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): freshwater biome → planetary subsurface zone → groundwater
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: USA: Rifle, Colorado
• Coordinates
  • Lat. (^o): 39.53
  • Long. (^o): -107.78
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073159	Metagenome / Metatranscriptome	120	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
C687J26661_1004993	All Organisms → cellular organisms → Bacteria	2231

Sequences

Scaffold ID	Protein ID	Family	Sequence
C687J26661_1004993	C687J26661_10049932	F073159	MARRKKHAVRSGAGSMCNICGRNCGKGGALRTHIEGAHKVSYDAYKTCFYGDVKTQIADTWDDSVKTHGGQTVITHVLVRRFIGNPGERGVRRKVP*