| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300002065 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0085351 | Gp0061083 | Ga0011311 |
| Sample Name | Macroalgal surface ecosystem from Botany Bay, Galicia, Spain - SA3-P2 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 286829789 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Macroalgal Surface Microbial Communities |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface → Macroalgal Surface Microbial Communities |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Surface (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Vigo, Galicia, Spain | |||||||
| Coordinates | Lat. (o) | 42.52 | Long. (o) | -8.82 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F059010 | Metagenome / Metatranscriptome | 134 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| SA3_10050191 | Not Available | 584 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| SA3_10050191 | SA3_100501912 | F059010 | MTRQELLNQVAEKLERCEHTPIVTEKEELQIWAMLLNKVYEETFKTKDVK* |
| ⦗Top⦘ |