3300002061: Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - A-R2

Overview

Basic Information

• IMG/M Taxon OID: 3300002061
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0085351 | Gp0061079 | Ga0016880
• Sample Name: Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - A-R2
• Sequencing Status: Permanent Draft
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 218991193
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Macroalgal Surface Microbial Communities
• Type: Host-Associated
• Taxonomy: Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface → Macroalgal Surface Microbial Communities

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Surface (saline)

Location Information

• Location: Botany Bay, Sydney, NSW, Australia
• Coordinates
  • Lat. (^o): -33.966629
  • Long. (^o): 151.166614
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028441	Metagenome / Metatranscriptome	191	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
AR2_1748933	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium	1258

Sequences

Scaffold ID	Protein ID	Family	Sequence
AR2_1748933	AR2_17489331	F028441	MTLKQLIKLENKAKEVWVVSPTLHYDIENKEFSEIVSVNLGEQTKYRYIVPGTRLVEKNIKAYKKMYDVSEAEIATNFLILPASEFIPFLEETAIYNASTDCVACAAPATENSNDVIKFNEDTSKAMAKAFKALWKKYKRTNKSTSWIIEISSCFIPKRSY