NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300002056

3300002056: Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - A-A4



Overview

Basic Information
IMG/M Taxon OID3300002056 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0085351 | Gp0061077 | Ga0016750
Sample NameMacroalgal surface ecosystem from Botany Bay, Sydney, Australia - A-A4
Sequencing StatusPermanent Draft
Sequencing CenterJ. Craig Venter Institute (JCVI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size177665328
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3
All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMacroalgal Surface Microbial Communities
TypeHost-Associated
TaxonomyHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface → Macroalgal Surface Microbial Communities

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Surface (saline)

Location Information
LocationBotany Bay, Sydney, NSW, Australia
CoordinatesLat. (o)-33.966629Long. (o)151.166614Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F028441Metagenome / Metatranscriptome191Y
F037503Metagenome / Metatranscriptome168Y
F051159Metagenome / Metatranscriptome144Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
AA4_1000039All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes192770Open in IMG/M
AA4_1000182All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes42905Open in IMG/M
AA4_1001183All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes8121Open in IMG/M
AA4_1031967All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium568Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
AA4_1000039AA4_100003926F051159MENILIVLCILILASAFGGTQLPKLPGAILSLGALFLAMFNGHALDNMASTFFIIPIILVIVGVLSYLAEKRLATEGANASSRDQLLGGSIFQVIFILIVTIYFVSTFFFPHFS*
AA4_1000182AA4_100018220F028441MTLKQLIKLENKAKEVWVVSPTLHYDVDNKDFTEIVSVNLGEKTKYRYIVPASKTVLKNVKLYKKMYNVSEEEVDRNFLFLPESDFNPFITECAIYNASSESVAVAAPATEDSNDVIRFNPQTSAEMTKQFKALWKKYKRRNP*
AA4_1001183AA4_10011832F028441MNKMTLKQLIKLENKSQVIWVVSPSLHYDVENKDFNEIVSVNLGQKAKYRYIVPATPAITKNMKLYQKMYGLTTEEMGNNFLLLPESEFNPFITETAIYDPTGECVACCAPATEDSKDVIKFNQQTAKMMCKSFKSIWKKYKRSNP*
AA4_1031967AA4_10319671F037503GLGGFTAYQPLTNSECREYIPAVRLWVLRSIAERETTQTIS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.