3300002019: Switchgrass rhizosphere and bulk soil microbial communities from Knoxville, Tennessee, USA - plot1-3

Overview

Basic Information

• IMG/M Taxon OID: 3300002019
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0103013 | Gp0060265 | Ga0016710
• Sample Name: Switchgrass rhizosphere and bulk soil microbial communities from Knoxville, Tennessee, USA - plot1-3
• Sequencing Status: Permanent Draft
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 13365584
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Switchgrass Rhizosphere And Bulk Soil Microbial Communities From Knoxville, Tennessee, Usa
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Clay → Grasslands → Switchgrass Rhizosphere And Bulk Soil → Switchgrass Rhizosphere And Bulk Soil Microbial Communities From Knoxville, Tennessee, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): grassland biome → land → bulk soil
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere

Location Information

• Location: Knoxville, Tennessee, USA
• Coordinates
  • Lat. (^o): 35.9728
  • Long. (^o): -83.9422
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007321	Metagenome / Metatranscriptome	353	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
plot13_105317	Not Available	512

Sequences

Scaffold ID	Protein ID	Family	Sequence
plot13_105317	plot13_1053172	F007321	MRARTLQTWIARHILVRRRLESICTSYLLFLMVVTTKHSLEEAARFSGLHKSQFSKMLKGHRDVAVST