Basic Information | |
---|---|
IMG/M Taxon OID | 3300001933 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0055716 | Gp0055242 | Ga0016855 |
Sample Name | Marine microbial communities from Moorea, Cooks Bay - GS048a |
Sequencing Status | Permanent Draft |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 666592 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Marine Microbial Communities From Global Ocean Sampling (Gos) |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | marine biome → intertidal zone → sea water |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Moorea, Outside Cooks Bay, Polynesia Archipelagos | |||||||
Coordinates | Lat. (o) | -17.475834 | Long. (o) | -149.81223 | Alt. (m) | N/A | Depth (m) | 1.4 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F004325 | Metagenome / Metatranscriptome | 443 | Y |
F027869 | Metagenome | 193 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
GOS2263_10031 | Not Available | 1874 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
GOS2263_10031 | GOS2263_100312 | F027869 | MEHKKAKKAKKMAEQAMELMALEDAMAEANEADLQPEDGYINPMGRIGTVPPSTYSLGNMLNGTTTQSVINPET* |
GOS2263_10031 | GOS2263_100313 | F004325 | MKKKKSTTEKADQFLSGLGTAGGAIGSPQLMGFGGTDIQNQVMSGNMDEYANIRMRQDEIKIGESAAMPPDLDASYLKLNLPGSPLPVNGLLAPQNIIGAQQTQDMIRSEEQMF |
⦗Top⦘ |