3300001927: Marine microbial communities from Polynesia - GS044

Overview

Basic Information

• IMG/M Taxon OID: 3300001927
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0055716 | Gp0056506 | Ga0016843
• Sample Name: Marine microbial communities from Polynesia - GS044
• Sequencing Status: Permanent Draft
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 562395
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Predicted Viral	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Marine Microbial Communities From Global Ocean Sampling (Gos)
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Polynesia
• Coordinates
  • Lat. (^o): -8.415
  • Long. (^o): -124.23972
  • Alt. (m): N/A
  • Depth (m): 2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079363	Metagenome / Metatranscriptome	116	N

Associated Scaffolds

Scaffold	Taxonomy	Length
GOS2259_10090	All Organisms → Viruses → Predicted Viral	1329

Sequences

Scaffold ID	Protein ID	Family	Sequence
GOS2259_10090	GOS2259_100903	F079363	IKVYEEYNSIGLGGVYDLGIASLKLGYYTESEFDVDYLTLGGSIDAGIVDLSLAYYYNTDSFHNETLMISFGFDL*