| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300001926 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0055716 | Gp0056504 | Ga0016842 |
| Sample Name | Marine microbial communities from the Tropical South Pacific Ocean - GS042 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 542583 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → Viruses → Predicted Viral | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Microbial Communities From Global Ocean Sampling (Gos) |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine water body → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | South Pacific Ocean | |||||||
| Coordinates | Lat. (o) | -7.1075 | Long. (o) | -116.11916 | Alt. (m) | N/A | Depth (m) | 1.7 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F004144 | Metagenome / Metatranscriptome | 451 | Y |
| F094398 | Metagenome / Metatranscriptome | 106 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| GOS2257_10221 | All Organisms → Viruses → Predicted Viral | 1639 | Open in IMG/M |
| GOS2257_10263 | All Organisms → Viruses → Predicted Viral | 1554 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| GOS2257_10221 | GOS2257_102211 | F094398 | VLTSEFGISASTTISDWAQLRFTGTLNTNVDGETMRLKDLEGTNSDLDHRNNFAFPTDITQEPS* |
| GOS2257_10263 | GOS2257_102632 | F004144 | MKNILKEAKYHLEIETGWSYQYHLWHSIKNSALLIKISFKSLVHGLLPFMWKSDAPKDIIILYHTIMKIQHIKKMDKLREVSKSKRYE* |
| ⦗Top⦘ |