3300001821: Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM23, ROCA_DNA122_2.0um_25a

Overview

Basic Information

• IMG/M Taxon OID: 3300001821
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0096913 | Gp0056341 | Ga0016724
• Sample Name: Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM23, ROCA_DNA122_2.0um_25a
• Sequencing Status: Permanent Draft
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 13226016
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → plume front → planktonic material
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Amazon River plume to Atlantic Ocean
• Coordinates
  • Lat. (^o): 11.3123
  • Long. (^o): -56.4267
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000918	Metagenome / Metatranscriptome	834	Y
F010827	Metagenome / Metatranscriptome	298	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
ACM23_113781	Not Available	620
ACM23_114528	Not Available	677

Sequences

Scaffold ID	Protein ID	Family	Sequence
ACM23_113781	ACM23_1137812	F000918	MYKTNQQAWNEVMRGIKESERQTKICQEMFGQDNLIGLTEEQRRKFHESI*
ACM23_114528	ACM23_1145281	F010827	SGTFDHYHINSYSNEEACKQGKAEAKVLVTSQNSKVVCIKIER*