NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001814

3300001814: Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR12Aug_CSW13A



Overview

Basic Information
IMG/M Taxon OID3300001814 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053062 | Gp0055516 | Ga0004661
Sample NameSerpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR12Aug_CSW13A
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size73246877
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSerpentinite Rock And Fluid Microbial Communities From Tablelands Ophiolite (Newfoundland), Coast Range Ophiolite (California) And Ligurian Springs (Italy)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid → Serpentinite Rock And Fluid Microbial Communities From Tablelands Ophiolite (Newfoundland), Coast Range Ophiolite (California) And Ligurian Springs (Italy)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeplanetary subsurface zonerock
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationUSA: California, McLaughlin Reserve
CoordinatesLat. (o)38.8739528Long. (o)-122.4391613Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F067528Metagenome / Metatranscriptome125Y
F090615Metagenome / Metatranscriptome108N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI24120J20309_1000249All Organisms → cellular organisms → Bacteria → Proteobacteria36749Open in IMG/M
JGI24120J20309_1005773All Organisms → cellular organisms → Bacteria → Proteobacteria1837Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI24120J20309_1000249JGI24120J20309_100024929F090615MRALQLAAPEPTDPSLIAALRVRKGWLRPDSPIVDKAAAEGLKKLGVLLCPPPDPDGKSIPERRFIDIATEYLKAVPQARLLIEESAVEHQASWDPDKVYVERTDADIHEEMVTAIKIANGERLRAARAKASAGS*
JGI24120J20309_1005773JGI24120J20309_10057732F067528LDFSELAQSGGSEQNSVSIALKPLYEGAFFKLWSGGDREKVNQINSLSAAVERLKI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.