3300001667: barOA

Overview

Basic Information

• IMG/M Taxon OID: 3300001667
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0096604 | Gp0055468 | Ga0013014
• Sample Name: barOA
• Sequencing Status: Permanent Draft
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 11034474
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Marine Microbial Communities From The Santa Barbara Basin, California, Usa
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Cold Seeps → Unclassified → Marine → Marine Microbial Communities From The Santa Barbara Basin, California, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine cold seep biome → cold seep → marine sediment
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: USA: California: Santa Barbara Basin
• Coordinates
  • Lat. (^o): 13.2648
  • Long. (^o): -59.4253
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016971	Metagenome / Metatranscriptome	243	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
OAud_106139	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	529

Sequences

Scaffold ID	Protein ID	Family	Sequence
OAud_106139	OAud_1061391	F016971	MKQVAQHLPNEEKCAVEIVVHVSKNLGDEQQNQVVSALKETDGIIGAEFCLMRNHLVLAKYDRGSMSSQDVLKSFNSLNLDARLIGPI*