3300001665: barSA

Overview

Basic Information

• IMG/M Taxon OID: 3300001665
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0096604 | Gp0056110 | Ga0012983
• Sample Name: barSA
• Sequencing Status: Permanent Draft
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 7818637
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Marine Microbial Communities From The Santa Barbara Basin, California, Usa
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Cold Seeps → Unclassified → Marine → Marine Microbial Communities From The Santa Barbara Basin, California, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine cold seep biome → cold seep → marine sediment
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: USA: California: Santa Barbara Basin
• Coordinates
  • Lat. (^o): 13.2648
  • Long. (^o): -59.4253
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037503	Metagenome / Metatranscriptome	168	Y
F095492	Metagenome / Metatranscriptome	105	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
SAud_103685	Not Available	561
SAud_103801	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis	553

Sequences

Scaffold ID	Protein ID	Family	Sequence
SAud_103685	SAud_1036851	F095492	EDIVSTHTNLEKSSKFEEVIMRTKATIVMFAIVLTAMLCPISALGTKTEAVETKAKLETLVDEYIACCAAKSALRHSRSEKIRNSAMRSCKKAAYCKRSKAELVEVMLENNIEPKAYKVRLFLNQKFSGALQAKE*
SAud_103801	SAud_1038011	F037503	MRLGAASRNSVIEVELLIRLGGFTTYQTLTNSECYDIYSGVRHRVLRSYAERETTQIIS*