3300001610: Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF026

Overview

Basic Information

• IMG/M Taxon OID: 3300001610
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0085736 | Gp0057307 | Ga0003865
• Sample Name: Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF026
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 681669
• Sequencing Scaffolds: 1
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Forest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): forest biome → solid layer → forest soil
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: Harvard Forest LTER, Petersham, MA, USA
• Coordinates
  • Lat. (^o): 42.471116
  • Long. (^o): -72.17263
  • Alt. (m): N/A
  • Depth (m): 0 to .1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007280	Metagenome / Metatranscriptome	354	Y
F089285	Metagenome / Metatranscriptome	109	N

Associated Scaffolds

Scaffold	Taxonomy	Length
JGI20260J16341_10180	Not Available	673

Sequences

Scaffold ID	Protein ID	Family	Sequence
JGI20260J16341_10180	JGI20260J16341_101802	F089285	TTIQHTAHHPGAGIEICYPYHPLYRQTATVLRVEHTKGESHLRVITEAGEERLIPRWMSDPNAFQPSSVEQPLIGLDALRHLLRVVFSSPLHLSRRDQEGRRDDPIAPVSAASEPQRATSQQGVQRSERPCRQPADCSDCGEQKETAAAGDRQP*
JGI20260J16341_10266	JGI20260J16341_102661	F007280	LPGKLDNIGRETLLVVTTTGDLALCRAMLPERRAGATLGDMQLRSDLLNAGTATRGA*