| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300001426 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0090294 | Gp0057574 | Ga0003950 |
| Sample Name | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 6899636 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 1 |
| All Organisms → cellular organisms → Bacteria → Acidobacteria | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Kellogg Biological Station, Michigan, USA | |||||||
| Coordinates | Lat. (o) | 42.3948 | Long. (o) | -85.3738 | Alt. (m) | N/A | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007980 | Metagenome / Metatranscriptome | 341 | Y |
| F017247 | Metagenome | 242 | Y |
| F021829 | Metagenome | 217 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| JGI24030J14995_100079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 2103 | Open in IMG/M |
| JGI24030J14995_101802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| JGI24030J14995_102410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| JGI24030J14995_100079 | JGI24030J14995_1000793 | F017247 | NEDEYENNPELVVYSALYAAICGISIWLLVFHPESPTNWVLYILIIGSILAGLVKFALHSRKRHQQSL* |
| JGI24030J14995_101802 | JGI24030J14995_1018021 | F007980 | VSVALAFAAGVVACVIWRGGLIDSTAAAFVVRVGPEEAPLQTPQTWLALLLIVTISTSAGFFVGRVGARRSFVILASGFILMCTASLLVSRYLKIDILFVPMAIAATLAVLLVQLQRLWLIDTLLTERVNETISRTDGLGMSVAENRLTSGLKLLQTVLPLEEAIVFQPDESGALVPCARLRGQQNGSTAAGRNSVWRKLIKL |
| JGI24030J14995_102410 | JGI24030J14995_1024101 | F021829 | MPKIFLLLTLILFPSTITAQVYTVLTFDGKGDCADASLADAAQLAYRYDKQQDILWFRIALYGEPNKDAFGVNLAIDTGGDDSTKMNWWGANKTFKFDRLVTANVTRRDKGFVGTMGVADAAGVNAKQMNNLRQNNLQI |
| ⦗Top⦘ |