3300001391: Hydrothermal vent microbial communities from the Southwest Indian Ridge - SWIR1

Overview

Basic Information

• IMG/M Taxon OID: 3300001391
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0090378 | Gp0055594 | Ga0012453
• Sample Name: Hydrothermal vent microbial communities from the Southwest Indian Ridge - SWIR1
• Sequencing Status: Permanent Draft
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 55292183
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Hydrothermal Vent Microbial Communities From The Southwest Indian Ridge
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Hydrothermal Vent Microbial Communities From The Southwest Indian Ridge

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine hydrothermal vent biome → marine hydrothermal vent → hydrothermal fluid
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008223	Metagenome / Metatranscriptome	337	Y
F059476	Metagenome / Metatranscriptome	134	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
SWIR1_1016497	Not Available	993
SWIR1_1030884	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	557

Sequences

Scaffold ID	Protein ID	Family	Sequence
SWIR1_1016497	SWIR1_10164972	F008223	MGIFKKLFGKQAHTPTVTEAVGKIIDRFATATSMGVDREALARYPARQYQVMAFHYGAIDYLSQQHQLDETQTLGVFVIFINTYFTMPITETGSISERLRGFSEKPDERRYMEAGADAFRRWHEQNERRAPLELGEMLNKE*
SWIR1_1030884	SWIR1_10308842	F059476	LVKKMAEQNNRQQSIRMVITVVLLVLLALGFFAASFFALS*