3300001332: Hypersaline viral communities from Bras del Port, Santa Pola, Spain

Overview

Basic Information

• IMG/M Taxon OID: 3300001332
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0069917 | Gp0054897 | Ga0011177
• Sample Name: Hypersaline viral communities from Bras del Port, Santa Pola, Spain
• Sequencing Status: Permanent Draft
• Sequencing Center: Lifesequencing S.L.
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 118104459
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Hypersaline Viral And Bacterial Communities From Bras Del Port, Santa Pola, Spain
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Hypersaline Samples → Hypersaline Viral And Bacterial Communities From Bras Del Port, Santa Pola, Spain

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): aquatic biome → saline evaporation pond → hypersaline water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Hypersaline (saline)

Location Information

• Location: Mediterranean Sea
• Coordinates
  • Lat. (^o): 38.2
  • Long. (^o): 0.6
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066493	Metagenome	126	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
CR30All_1000502	Not Available	603

Sequences

Scaffold ID	Protein ID	Family	Sequence
CR30All_1000502	CR30All_10005023	F066493	MSEREWHDGVVDVADELVQEHSAEGAIEHLQTRRQSSSEQLQQRCTEAIAYIRREVLADE