NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001262

3300001262: Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY74



Overview

Basic Information
IMG/M Taxon OID3300001262 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0085351 | Gp0054608 | Ga0012394
Sample NameMacroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY74
Sequencing StatusPermanent Draft
Sequencing CenterJ. Craig Venter Institute (JCVI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size1315585172
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMacroalgal Surface Microbial Communities
TypeHost-Associated
TaxonomyHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface → Macroalgal Surface Microbial Communities

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Surface (saline)

Location Information
LocationBotany Bay, Sydney, NSW, Australia
CoordinatesLat. (o)-33.966629Long. (o)151.166614Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F028441Metagenome / Metatranscriptome191Y
F079616Metagenome115Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
BBAY74_10032569All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2120Open in IMG/M
BBAY74_10313748All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium548Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
BBAY74_10032569BBAY74_100325692F028441MTLKQLIKLENKATEVWVVSPTLHYDVENKDFTEIVSVNLDEKTKYRYVVPASKTVLNNVKIYKEKYGVSNAEIDANFLFLPETDFNPFVQECAIYNASKKCVAVAAPATEDSNDVIRFNDKTAKAMARHYRALWRKYKRKNP*
BBAY74_10313748BBAY74_103137481F079616VVCTNAKRRWYRLGGLKKGEMYTIEGFNPFDGGLILKESKSPSSGYNAYRADRFRKVDYAFANTILENIQPQETENIELIPATLQGFFLSLFKLS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.