NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001123

3300001123: Marine microbial communities from the Deep Atlantic Ocean - MP2969



Overview

Basic Information
IMG/M Taxon OID3300001123 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053074 | Gp0054569 | Ga0000752
Sample NameMarine microbial communities from the Deep Atlantic Ocean - MP2969
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size51412913
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Calditrichaeota → Calditrichia → Calditrichales → Calditrichaceae → Caldithrix → Caldithrix abyssi1
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosarchaeum → Candidatus Nitrosarchaeum limnium1
Not Available1
All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDeep Ocean Microbial Communities From The Global Malaspina Expedition
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationSouth of Funchal, North Atlantic Ocean
CoordinatesLat. (o)32.08Long. (o)-17.26Alt. (m)N/ADepth (m)4002.6
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F041257Metagenome / Metatranscriptome160N
F076187Metagenome118Y
F082562Metagenome113N
F089571Metagenome109N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI11949J13268_1000278All Organisms → cellular organisms → Bacteria → Calditrichaeota → Calditrichia → Calditrichales → Calditrichaceae → Caldithrix → Caldithrix abyssi7028Open in IMG/M
JGI11949J13268_1001895All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosarchaeum → Candidatus Nitrosarchaeum limnium2479Open in IMG/M
JGI11949J13268_1011779Not Available702Open in IMG/M
JGI11949J13268_1012543All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium677Open in IMG/M
JGI11949J13268_1019814All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium517Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI11949J13268_1000278JGI11949J13268_10002784F089571MFIIYLGKENERKMLKNIIVIVFSVLFLVVPASSQHVQQKYAITDKDEKVILNDNGTWEYAEEDKQNYYYKKVPPKTYNYEFKSQTWEERIEQXAHEYWRIRAHAELEQLGIPVTRYDPTTSDVPLYLKLEGGRIRTDFDSFTPLARGEVIDISGLWDPDKGDNPTLKIQGKLFLQITMKLDDQKKLFSQYNQRNYIPIPDDFQRILEFRDSLDVISLGMHDYNRDNTHIWPGIPHSFLYAPPGSYYDPNNPPIIHGDGFPYIQRGHLTLSRREIPMTNSVYDNLLKRIDNLEGHGXIKIRYDMGKGIIETVTFEEVWLKINPYNGDPTHILKKVSLNKLE*
JGI11949J13268_1001895JGI11949J13268_10018958F076187MPDCINPALTVSVIICPDGLVSVAITHFFEFISTEKFFENFKTSRNVKSFPNIPLIPDTDIFNASNLDTLFINSERK*
JGI11949J13268_1011779JGI11949J13268_10117791F041257MQEFKPNYRPLGSEEDDVVDPRSEQADGPFDHERFKTLTVLAHAAGRVMDRYAIKGFDGFTNRQADWACKLQSFFNLSNTFETLVLLLFTFQFSQNERFDLEMGKTEPIDRSHPLSQALMAWVWWDPSSETSRVDRFYPWEYGEERTXRMVAIASGLLPEPIDVT
JGI11949J13268_1012543JGI11949J13268_10125431F082562TVLFAQASDSSNNYFFNIELSLIHPILGGFGGTVGIEKNHFSYGLNSFGTKLNHMTKHYLLENAEELAVYNWGVELYSDYYFKQNHTGLFLGLILSLNGFRFNDIPNPQTILVLYSAPRIGYRLCLPKKLKSFYFQYSLTTHFKVWDDEKKFLYREIDTKSIFLLSQLTLGVKI*
JGI11949J13268_1019814JGI11949J13268_10198141F082562NLFAQTNDSLRNYFLDIELSIIHPILGGFGGTIGIERNHSSFGVMGFGTKLNHMMKHYFIEDAEELAVYNWGVELYSDYYIKQNHRGLFIGSLVSINGFRFTDIPNPQTILVLYAVPRVGYRIYLPKKLNAFYFQPSLTAHIKFWDNQEQFLYREIDTKSIFLLSQLTLGMK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.