3300001106: Marine microbial communities from the Deep Atlantic Ocean - MP0327

Overview

Basic Information

• IMG/M Taxon OID: 3300001106
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053074 | Gp0054659 | Ga0000810
• Sample Name: Marine microbial communities from the Deep Atlantic Ocean - MP0327
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 31899950
• Sequencing Scaffolds: 3
• Novel Protein Genes: 3
• Associated Families: 3

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota	1
Not Available	1
All Organisms → cellular organisms → Bacteria → Calditrichaeota → Calditrichia → Calditrichales → Calditrichaceae → Caldithrix → Caldithrix abyssi	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Deep Ocean Microbial Communities From The Global Malaspina Expedition
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: East of Recife, Brazil, South Atlantic Ocean
• Coordinates
  • Lat. (^o): -9.12
  • Long. (^o): -30.19
  • Alt. (m): N/A
  • Depth (m): 4001.48

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013096	Metagenome / Metatranscriptome	274	Y
F057445	Metagenome / Metatranscriptome	136	N
F089571	Metagenome	109	N

Associated Scaffolds

Scaffold	Taxonomy	Length
JGI11978J13257_1000708	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota	3268
JGI11978J13257_1000974	Not Available	2771
JGI11978J13257_1002888	All Organisms → cellular organisms → Bacteria → Calditrichaeota → Calditrichia → Calditrichales → Calditrichaceae → Caldithrix → Caldithrix abyssi	1562

Sequences

Scaffold ID	Protein ID	Family	Sequence
JGI11978J13257_1000708	JGI11978J13257_10007081	F013096	MVTDVVGDSAVGLSTLSHTNTVAVYEPEALGVHDNAG
JGI11978J13257_1000974	JGI11978J13257_10009742	F057445	LQKLSKAAVNEILPKAVSLILIKERLENKRKKDFLDLXDLFSVAPDVIKIM*
JGI11978J13257_1002888	JGI11978J13257_10028882	F089571	MFIIYLDKENERKMLKNIIVIVFSVLFLVVPASSQHVQQKYAITDKDEKVILNDNGTWEYAEEDKQNYYYKKVPPKTYNYEFKSQTWEERIEQAAHEYWRIRAHAELEQLGIPVTRYDPTTSDVPLYLKLEGGRIRTDFDSFTPLAKGEVIDISGLWDPDKGDNPTLKIQGKLFLQITMKLDDQKKLFSQYEQRNYIPLPEDFQRILEFRDSLDVISLGMHDYNRDNTHIWPGIPHSFLYAPPGSYYDPNNPPIIHGDGFPYIQRGHLTLSRREIPMTNSVYDNLLKRIDNLEGHGPIKIRYDMGKGIIETVTFEEVWLKINPYNGDPTHILKNVSLKKLE*