3300001091: Marine microbial communities from the Deep Atlantic Ocean - MP0203

Overview

Basic Information

• IMG/M Taxon OID: 3300001091
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053074 | Gp0054677 | Ga0000815
• Sample Name: Marine microbial communities from the Deep Atlantic Ocean - MP0203
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 42896525
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Deep Ocean Microbial Communities From The Global Malaspina Expedition
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: South of Cape Verde, Atlantic Ocean
• Coordinates
  • Lat. (^o): 7.33
  • Long. (^o): -26.0
  • Alt. (m): N/A
  • Depth (m): 4002.51

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006552	Metagenome	370	Y
F052659	Metagenome / Metatranscriptome	142	N

Associated Scaffolds

Scaffold	Taxonomy	Length
JGI12218J13221_1003213	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2018
JGI12218J13221_1008099	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae	910

Sequences

Scaffold ID	Protein ID	Family	Sequence
JGI12218J13221_1003213	JGI12218J13221_10032132	F052659	MLLSGNPGTETRSAVFIDGRLISSIPELNYQTIDKLQQGGVPDKVSWMKPSLRGRLRLVKLQAQERNLTIEDLNQSIRSKWVIL*
JGI12218J13221_1008099	JGI12218J13221_10080993	F006552	INQYPTVWEATPKVEIPLLISPVLKIKSSRINPVANIPKPIPIAKKAIDILNNVGLPVFLNPIYEIVPITRPTKSPTKFRIISRKNSNYADSATVLNKVSEQVF*