3300001009: Grasslands soil microbial communities from Chapel Hill, North Carolina, USA that are Nitrogen fertilized -NN352

Overview

Basic Information

• IMG/M Taxon OID: 3300001009
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053063 | Gp0054365 | Ga0002529
• Sample Name: Grasslands soil microbial communities from Chapel Hill, North Carolina, USA that are Nitrogen fertilized -NN352
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 117241
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): grassland biome → land → grassland soil
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: Chapel Hill, North Carolina, USA
• Coordinates
  • Lat. (^o): 35.913
  • Long. (^o): -79.056
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025553	Metagenome / Metatranscriptome	201	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
JGI12523J13124_1001	All Organisms → cellular organisms → Bacteria	1720

Sequences

Scaffold ID	Protein ID	Family	Sequence
JGI12523J13124_1001	JGI12523J13124_10012	F025553	MKPVSWDKQLGLASPLETAASQSGKIKSPSNKEAGLDVSHHALVSREGRGENFFLDILFYRMS