3300000985: Sinkhole freshwater microbial communities from Lake Huron, USA - r2gDNA Night3

Overview

Basic Information

• IMG/M Taxon OID: 3300000985
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0045862 | Gp0056068 | Ga0011757
• Sample Name: Sinkhole freshwater microbial communities from Lake Huron, USA - r2gDNA Night3
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Michigan
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 35639022
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Sinkhole Freshwater Microbial Communities From Lake Huron, Us
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater → Sinkhole Freshwater Microbial Communities From Lake Huron, Us

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): freshwater lake biome → sinkhole → fresh water
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: Middle Island Sinkhole, Lake Huron Michigan, USA
• Coordinates
  • Lat. (^o): 45.19843
  • Long. (^o): -83.32721
  • Alt. (m): N/A
  • Depth (m): 23

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058147	Metagenome	135	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
KEY_1038286	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	15937

Sequences

Scaffold ID	Protein ID	Family	Sequence
KEY_1038286	KEY_10382862	F058147	MQRQSIIVFIQGNRIETYGNLKKCCEFEKLKYHTLARLKFPIMVNDIVIHKTMFK*