3300000984: Marine microbial communities from the Deep Atlantic Ocean - MP0371

Overview

Basic Information

• IMG/M Taxon OID: 3300000984
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053074 | Gp0053872 | Ga0000809
• Sample Name: Marine microbial communities from the Deep Atlantic Ocean - MP0371
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 16939769
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Deep Ocean Microbial Communities From The Global Malaspina Expedition
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: East of Porto Seguro, South Atlantic Ocean
• Coordinates
  • Lat. (^o): -15.83
  • Long. (^o): -33.41
  • Alt. (m): N/A
  • Depth (m): 4003.17

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003507	Metagenome / Metatranscriptome	482	Y
F032684	Metagenome / Metatranscriptome	179	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
JGI11765J13083_102505	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	1175
JGI11765J13083_106741	Not Available	549

Sequences

Scaffold ID	Protein ID	Family	Sequence
JGI11765J13083_102505	JGI11765J13083_1025051	F003507	EVLCRFRGRIDEALMNEFVAIQSAVAIDEGLVSPKHLVVDTFPSEQGSQRVTDATTLYKAKKNSLKSQNRSQID*
JGI11765J13083_106741	JGI11765J13083_1067411	F032684	MILLCTLRVLALIDKFKSNFSLFKAEEVMFLPFGIITKNTLKNIIQPKITPTDKNANL