3300000954: Marine sediment microbial community from Cabo Rojo, Puerto Rico - PR CR 10% Liquid 1

Overview

Basic Information

• IMG/M Taxon OID: 3300000954
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053056 | Gp0053374 | Ga0001432
• Sample Name: Marine sediment microbial community from Cabo Rojo, Puerto Rico - PR CR 10% Liquid 1
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 170874585
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine Sediment → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine benthic biome → marine benthic feature → marine sediment
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Cabo Rojo, Puerto Rico
• Coordinates
  • Lat. (^o): 17.951083
  • Long. (^o): -67.193167
  • Alt. (m): N/A
  • Depth (m): .05

Associated Families

Family	Category	Number of Sequences	3D Structure?
F102576	Metagenome	101	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
JGI1689J12820_1000125	All Organisms → cellular organisms → Bacteria	13360

Sequences

Scaffold ID	Protein ID	Family	Sequence
JGI1689J12820_1000125	JGI1689J12820_100012512	F102576	VENLLKLEEYFPGGELMGGIELANRMDWGLSLQLSGEDWVVSSGGEPIYTTDCKESLQSFVYGLGLAYAVLPRKLFDELVDNVRNL*