| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300000939 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0045862 | Gp0056066 | Ga0011766 |
| Sample Name | Sinkhole freshwater microbial communities from Lake Huron, USA - r2gDNA Day3 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Michigan |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 51371394 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Sinkhole Freshwater Microbial Communities From Lake Huron, Us |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater → Sinkhole Freshwater Microbial Communities From Lake Huron, Us |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | freshwater lake biome → sinkhole → fresh water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Middle Island Sinkhole, Lake Huron Michigan, USA | |||||||
| Coordinates | Lat. (o) | 45.19843 | Long. (o) | -83.32721 | Alt. (m) | N/A | Depth (m) | 23 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F081567 | Metagenome / Metatranscriptome | 114 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| KEY_1042818 | All Organisms → cellular organisms → Bacteria | 2810 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| KEY_1042818 | KEY_10428183 | F081567 | PMRVAIKATEEAIIRLLKAGHPLPGDVVDRELETRLPVFQSVEAVPVKTYGIEGLGRIVIARGRKDVWFVDIKRKDGKLSVKDGESFLDMRDKLQQRYPGQKVTGWLVTTADVDVKAKSVIAEKGCFATAGAAKR* |
| ⦗Top⦘ |